PIAS4 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PIAS4 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5322
• Hersteller Artikelnummer: A5322
• Alternativnummer: ABB-A5322-100UL,ABB-A5322-20UL,ABB-A5322-500UL,ABB-A5322-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PIASY, Piasg, ZMIZ6, PIAS-gamma, PIAS4

Produktbeschreibung

Enables SUMO ligase activity and ubiquitin protein ligase binding activity. Involved in negative regulation of transcription, DNA-templated, positive regulation of protein sumoylation, and protein sumoylation. Located in cytoplasm and nucleus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 57kDa
• NCBI: 51588
• UniProt: Q8N2W9
• Reinheit: Affinity purification
• Sequenz: ELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITV
• Target-Kategorie: PIAS4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using PIAS4 Rabbit pAb (A5322) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.