PIAS4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PIAS4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5322
• Supplier Catalog Number: A5322
• Alternative Catalog Number: ABB-A5322-100UL,ABB-A5322-20UL,ABB-A5322-500UL,ABB-A5322-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PIASY, Piasg, ZMIZ6, PIAS-gamma, PIAS4

Product Description

Enables SUMO ligase activity and ubiquitin protein ligase binding activity. Involved in negative regulation of transcription, DNA-templated, positive regulation of protein sumoylation, and protein sumoylation. Located in cytoplasm and nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 51588
• UniProt: Q8N2W9
• Purity: Affinity purification
• Sequence: ELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITV
• Target: PIAS4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using PIAS4 Rabbit pAb (A5322) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.