P23/PTGES3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: P23/PTGES3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5325
• Hersteller Artikelnummer: A5325
• Alternativnummer: ABB-A5325-100UL,ABB-A5325-20UL,ABB-A5325-500UL,ABB-A5325-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P23, TEBP, cPGES, P23/PTGES3

Produktbeschreibung

This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 19kDa
• NCBI: 10728
• UniProt: Q15185
• Reinheit: Affinity purification
• Sequenz: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
• Target-Kategorie: PTGES3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using P23/PTGES3 Rabbit pAb (A5325) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.