P23/PTGES3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: P23/PTGES3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5325
• Supplier Catalog Number: A5325
• Alternative Catalog Number: ABB-A5325-100UL,ABB-A5325-20UL,ABB-A5325-500UL,ABB-A5325-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: P23, TEBP, cPGES, P23/PTGES3

Product Description

This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 19kDa
• NCBI: 10728
• UniProt: Q15185
• Purity: Affinity purification
• Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
• Target: PTGES3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using P23/PTGES3 Rabbit pAb (A5325) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.