BPI Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: BPI Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5338
• Hersteller Artikelnummer: A5338
• Alternativnummer: ABB-A5338-20UL,ABB-A5338-100UL,ABB-A5338-500UL,ABB-A5338-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: rBPI, BPIFD1, BPI

Produktbeschreibung

This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 671
• UniProt: P17213
• Reinheit: Affinity purification
• Sequenz: AETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
• Target-Kategorie: BPI
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using BPI Rabbit pAb (A5338) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.