BPI Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BPI Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5338
• Supplier Catalog Number: A5338
• Alternative Catalog Number: ABB-A5338-20UL,ABB-A5338-100UL,ABB-A5338-500UL,ABB-A5338-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: rBPI, BPIFD1, BPI

Product Description

This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 671
• UniProt: P17213
• Purity: Affinity purification
• Sequence: AETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
• Target: BPI
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BPI Rabbit pAb (A5338) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.