Nectin 2/CD112 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5378
Artikelname: Nectin 2/CD112 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5378
Hersteller Artikelnummer: A5378
Alternativnummer: ABB-A5378-100UL,ABB-A5378-20UL,ABB-A5378-500UL,ABB-A5378-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HVEB, PRR2, CD112, PVRL2, PVRR2, Nectin 2/CD112
This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 5819
UniProt: Q92692
Reinheit: Affinity purification
Sequenz: FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Target-Kategorie: NECTIN2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using Nectin 2/CD112 Rabbit pAb (A5378) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).