Nectin 2/CD112 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5378
Article Name: Nectin 2/CD112 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5378
Supplier Catalog Number: A5378
Alternative Catalog Number: ABB-A5378-100UL,ABB-A5378-20UL,ABB-A5378-500UL,ABB-A5378-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HVEB, PRR2, CD112, PVRL2, PVRR2, Nectin 2/CD112
This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 5819
UniProt: Q92692
Purity: Affinity purification
Sequence: FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Target: NECTIN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using Nectin 2/CD112 Rabbit pAb (A5378) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).