SFRP2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SFRP2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5383
• Hersteller Artikelnummer: A5383
• Alternativnummer: ABB-A5383-100UL,ABB-A5383-20UL,ABB-A5383-1000UL,ABB-A5383-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FRP-2, SARP1, SDF-5, SFRP2

Produktbeschreibung

This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 33kDa
• NCBI: 6423
• UniProt: Q96HF1
• Reinheit: Affinity purification
• Sequenz: LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKG
• Target-Kategorie: SFRP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Growth factors,Wnt -Catenin Signaling Pathway,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Heart,Cardiogenesis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SFRP2 Rabbit pAb (A5383) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.