SFRP2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SFRP2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5383
• Supplier Catalog Number: A5383
• Alternative Catalog Number: ABB-A5383-100UL,ABB-A5383-20UL,ABB-A5383-1000UL,ABB-A5383-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FRP-2, SARP1, SDF-5, SFRP2

Product Description

This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 6423
• UniProt: Q96HF1
• Purity: Affinity purification
• Sequence: LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKG
• Target: SFRP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Growth factors,Wnt -Catenin Signaling Pathway,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Heart,Cardiogenesis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SFRP2 Rabbit pAb (A5383) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.