Annexin A6/Annexin VI Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Annexin A6/Annexin VI Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5390
• Hersteller Artikelnummer: A5390
• Alternativnummer: ABB-A5390-20UL,ABB-A5390-100UL,ABB-A5390-500UL,ABB-A5390-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p68, p70, ANX6, CBP68, CPB-II, Annexin A6/Annexin VI

Produktbeschreibung

Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 76kDa
• NCBI: 309
• UniProt: P08133
• Reinheit: Affinity purification
• Sequenz: MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR
• Target-Kategorie: ANXA6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using Annexin A6/Annexin VI Rabbit pAb (A5390) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.