Annexin A6/Annexin VI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5390
Article Name: Annexin A6/Annexin VI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5390
Supplier Catalog Number: A5390
Alternative Catalog Number: ABB-A5390-20UL,ABB-A5390-100UL,ABB-A5390-500UL,ABB-A5390-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p68, p70, ANX6, CBP68, CPB-II, Annexin A6/Annexin VI
Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 309
UniProt: P08133
Purity: Affinity purification
Sequence: MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR
Target: ANXA6
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates, using Annexin A6/Annexin VI Rabbit pAb (A5390) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.