SULT2A1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SULT2A1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5489
• Hersteller Artikelnummer: A5489
• Alternativnummer: ABB-A5489-20UL,ABB-A5489-100UL,ABB-A5489-1000UL,ABB-A5489-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HST, ST2, STD, hSTa, DHEAS, ST2A1, ST2A3, DHEA-ST, SULT2A3, DHEA-ST8, SULT2A1

Produktbeschreibung

This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 6822
• UniProt: Q06520
• Reinheit: Affinity purification
• Sequenz: MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS
• Target-Kategorie: SULT2A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Drug metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SULT2A1 Rabbit pAb (A5489) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.