SULT2A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5489
Article Name: SULT2A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5489
Supplier Catalog Number: A5489
Alternative Catalog Number: ABB-A5489-20UL,ABB-A5489-100UL,ABB-A5489-1000UL,ABB-A5489-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HST, ST2, STD, hSTa, DHEAS, ST2A1, ST2A3, DHEA-ST, SULT2A3, DHEA-ST8, SULT2A1
This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6822
UniProt: Q06520
Purity: Affinity purification
Sequence: MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS
Target: SULT2A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SULT2A1 Rabbit pAb (A5489) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.