UROD Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: UROD Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5493
• Hersteller Artikelnummer: A5493
• Alternativnummer: ABB-A5493-20UL,ABB-A5493-100UL,ABB-A5493-500UL,ABB-A5493-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PCT, UPD, UROD

Produktbeschreibung

This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 41kDa
• NCBI: 7389
• UniProt: P06132
• Reinheit: Affinity purification
• Sequenz: MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAP
• Target-Kategorie: UROD
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cardiovascular,Blood. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using UROD Rabbit pAb (A5493) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.