UROD Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UROD Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5493
• Supplier Catalog Number: A5493
• Alternative Catalog Number: ABB-A5493-20UL,ABB-A5493-100UL,ABB-A5493-500UL,ABB-A5493-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PCT, UPD, UROD

Product Description

This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 41kDa
• NCBI: 7389
• UniProt: P06132
• Purity: Affinity purification
• Sequence: MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAP
• Target: UROD
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cardiovascular,Blood. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UROD Rabbit pAb (A5493) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.