DNMT1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: DNMT1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5495
• Hersteller Artikelnummer: A5495
• Alternativnummer: ABB-A5495-20UL,ABB-A5495-100UL,ABB-A5495-1000UL,ABB-A5495-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AIM, DNMT, MCMT, CXXC9, HSN1E, ADCADN, m.HsaI, DNMT1

Produktbeschreibung

This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 183kDa
• NCBI: 1786
• UniProt: P26358
• Reinheit: Affinity purification
• Sequenz: GDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDI
• Target-Kategorie: DNMT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation. Shipping: Ice Bag

Bilder

Immunoprecipitation analysis of 200 µg extracts of 293T cells using 3 µg DNMT1 antibody (A5495). Western blot was performed from the immunoprecipitate using DNMT1 antibody (A5495) at a dilution of 1:1000.