DNMT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5495
Article Name: DNMT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5495
Supplier Catalog Number: A5495
Alternative Catalog Number: ABB-A5495-20UL,ABB-A5495-100UL,ABB-A5495-1000UL,ABB-A5495-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AIM, DNMT, MCMT, CXXC9, HSN1E, ADCADN, m.HsaI, DNMT1
This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 183kDa
NCBI: 1786
UniProt: P26358
Purity: Affinity purification
Sequence: GDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDI
Target: DNMT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation. Shipping: Ice Bag
Immunoprecipitation analysis of 200 µg extracts of 293T cells using 3 µg DNMT1 antibody (A5495). Western blot was performed from the immunoprecipitate using DNMT1 antibody (A5495) at a dilution of 1:1000.