ATIC Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ATIC Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5559
• Hersteller Artikelnummer: A5559
• Alternativnummer: ABB-A5559-100UL,ABB-A5559-20UL,ABB-A5559-500UL,ABB-A5559-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PURH, AICAR, AICARFT, IMPCHASE, HEL-S-70p, ATIC

Produktbeschreibung

This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 65kDa
• NCBI: 471
• UniProt: P31939
• Reinheit: Affinity purification
• Sequenz: MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKE
• Target-Kategorie: ATIC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Endocrine Metabolism,Nucleotide metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ATIC Rabbit pAb (A5559) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.