ATIC Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ATIC Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5559
• Supplier Catalog Number: A5559
• Alternative Catalog Number: ABB-A5559-100UL,ABB-A5559-20UL,ABB-A5559-500UL,ABB-A5559-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PURH, AICAR, AICARFT, IMPCHASE, HEL-S-70p, ATIC

Product Description

This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 65kDa
• NCBI: 471
• UniProt: P31939
• Purity: Affinity purification
• Sequence: MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKE
• Target: ATIC
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Endocrine Metabolism,Nucleotide metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using ATIC Rabbit pAb (A5559) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.