PKR/EIF2AK2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PKR/EIF2AK2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5578
• Hersteller Artikelnummer: A5578
• Alternativnummer: ABB-A5578-20UL,ABB-A5578-100UL,ABB-A5578-1000UL,ABB-A5578-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PKR, PRKR, DYT33, LEUDEN, EIF2AK1, PPP1R83, PKR/EIF2AK2

Produktbeschreibung

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. The encoded protein plays an important role in the innate immune response against multiple DNA and RNA viruses.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 62kDa
• NCBI: 5610
• UniProt: P19525
• Reinheit: Affinity purification
• Sequenz: MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKET
• Target-Kategorie: EIF2AK2

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Protein phosphorylation,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Apoptosis,Autophagy,Immunology Inflammation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using PKR/EIF2AK2 Rabbit pAb (A5578) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.3s.