PKR/EIF2AK2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PKR/EIF2AK2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5578
• Supplier Catalog Number: A5578
• Alternative Catalog Number: ABB-A5578-20UL,ABB-A5578-100UL,ABB-A5578-1000UL,ABB-A5578-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PKR, PRKR, DYT33, LEUDEN, EIF2AK1, PPP1R83, PKR/EIF2AK2

Product Description

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. The encoded protein plays an important role in the innate immune response against multiple DNA and RNA viruses.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 62kDa
• NCBI: 5610
• UniProt: P19525
• Purity: Affinity purification
• Sequence: MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKET
• Target: EIF2AK2

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Protein phosphorylation,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Apoptosis,Autophagy,Immunology Inflammation. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using PKR/EIF2AK2 Rabbit pAb (A5578) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.3s.