TWIST2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5599
Artikelname: TWIST2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5599
Hersteller Artikelnummer: A5599
Alternativnummer: ABB-A5599-100UL,ABB-A5599-20UL,ABB-A5599-500UL,ABB-A5599-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AMS, FFDD3, BBRSAY, DERMO1, SETLSS, bHLHa39, TWIST2
The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 117581
UniProt: Q8WVJ9
Reinheit: Affinity purification
Sequenz: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
Target-Kategorie: TWIST2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Rat uterus, using TWIST2 Rabbit pAb (A5599) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.