TWIST2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5599
Article Name: TWIST2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5599
Supplier Catalog Number: A5599
Alternative Catalog Number: ABB-A5599-100UL,ABB-A5599-20UL,ABB-A5599-500UL,ABB-A5599-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AMS, FFDD3, BBRSAY, DERMO1, SETLSS, bHLHa39, TWIST2
The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 117581
UniProt: Q8WVJ9
Purity: Affinity purification
Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
Target: TWIST2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Rat uterus, using TWIST2 Rabbit pAb (A5599) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.