F2R Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: F2R Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5641
• Hersteller Artikelnummer: A5641
• Alternativnummer: ABB-A5641-20UL,ABB-A5641-100UL,ABB-A5641-1000UL,ABB-A5641-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TR, HTR, CF2R, PAR1, PAR-1, F2R

Produktbeschreibung

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 2149
• UniProt: P25116
• Reinheit: Affinity purification
• Sequenz: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYT
• Target-Kategorie: F2R
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Cardiovascular,Angiogenesis,Blood. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using F2R Rabbit pAb (A5641) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.