F2R Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: F2R Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5641
• Supplier Catalog Number: A5641
• Alternative Catalog Number: ABB-A5641-20UL,ABB-A5641-100UL,ABB-A5641-1000UL,ABB-A5641-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TR, HTR, CF2R, PAR1, PAR-1, F2R

Product Description

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 2149
• UniProt: P25116
• Purity: Affinity purification
• Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYT
• Target: F2R
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Cardiovascular,Angiogenesis,Blood. Shipping: Ice Bag

Images

Western blot analysis of various lysates using F2R Rabbit pAb (A5641) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.