GNA13 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A5746
- Bilder (0)
| Artikelname: | GNA13 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A5746 |
| Hersteller Artikelnummer: | A5746 |
| Alternativnummer: | ABB-A5746-100UL,ABB-A5746-500UL,ABB-A5746-20UL,ABB-A5746-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G13, HG1N, GNA13 |
| Predicted to enable D5 dopamine receptor binding activity, G-protein beta/gamma-subunit complex binding activity, and GTPase activity. Predicted to be involved in several processes, including Rho protein signal transduction, activation of phospholipase D activity, and multicellular organism aging. Predicted to act upstream of or within several processes, including branching involved in blood vessel morphogenesis, negative regulation of vascular associated smooth muscle cell migration, and negative regulation of vascular associated smooth muscle cell proliferation. Located in cytosol and nucleus. |
| Molekulargewicht: | 44kDa |
| NCBI: | 10672 |
| UniProt: | Q14344 |
| Reinheit: | Affinity purification |
| Sequenz: | MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD |
| Target-Kategorie: | GNA13 |
| Application Verdünnung: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,mTOR Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,Cardiovascular,Angiogenesis. |
Produktgarantie und fachkundiger Support
