GNA13 Rabbit pAb, Unconjugated

Catalog Number: ABB-A5746
Article Name: GNA13 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A5746
Supplier Catalog Number: A5746
Alternative Catalog Number: ABB-A5746-100UL,ABB-A5746-500UL,ABB-A5746-20UL,ABB-A5746-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: G13, HG1N, GNA13
Predicted to enable D5 dopamine receptor binding activity, G-protein beta/gamma-subunit complex binding activity, and GTPase activity. Predicted to be involved in several processes, including Rho protein signal transduction, activation of phospholipase D activity, and multicellular organism aging. Predicted to act upstream of or within several processes, including branching involved in blood vessel morphogenesis, negative regulation of vascular associated smooth muscle cell migration, and negative regulation of vascular associated smooth muscle cell proliferation. Located in cytosol and nucleus.
Molecular Weight: 44kDa
NCBI: 10672
UniProt: Q14344
Purity: Affinity purification
Sequence: MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD
Target: GNA13
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,mTOR Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,Cardiovascular,Angiogenesis.