SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5782
• Hersteller Artikelnummer: A5782
• Alternativnummer: ABB-A5782-20UL,ABB-A5782-100UL,ABB-A5782-1000UL,ABB-A5782-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 19A, CS1, CD319, CRACC, SLAMF7

Produktbeschreibung

Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 57823
• UniProt: Q9NQ25
• Reinheit: Affinity purification
• Sequenz: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
• Target-Kategorie: SLAMF7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SLAMF7 Rabbit pAb (A5782) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.