SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5782
• Supplier Catalog Number: A5782
• Alternative Catalog Number: ABB-A5782-20UL,ABB-A5782-100UL,ABB-A5782-1000UL,ABB-A5782-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 19A, CS1, CD319, CRACC, SLAMF7

Product Description

Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 57823
• UniProt: Q9NQ25
• Purity: Affinity purification
• Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
• Target: SLAMF7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLAMF7 Rabbit pAb (A5782) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.