PRODH Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PRODH Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5836
• Hersteller Artikelnummer: A5836
• Alternativnummer: ABB-A5836-100UL,ABB-A5836-20UL,ABB-A5836-500UL,ABB-A5836-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: POX, PIG6, HSPOX2, PRODH1, PRODH2, TP53I6, PRODH

Produktbeschreibung

This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 68kDa
• NCBI: 5625
• UniProt: O43272
• Reinheit: Affinity purification
• Sequenz: IDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGT
• Target-Kategorie: PRODH
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PRODH Rabbit pAb (A5836) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.