PRODH Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PRODH Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5836
• Supplier Catalog Number: A5836
• Alternative Catalog Number: ABB-A5836-100UL,ABB-A5836-20UL,ABB-A5836-500UL,ABB-A5836-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: POX, PIG6, HSPOX2, PRODH1, PRODH2, TP53I6, PRODH

Product Description

This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 68kDa
• NCBI: 5625
• UniProt: O43272
• Purity: Affinity purification
• Sequence: IDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGT
• Target: PRODH
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PRODH Rabbit pAb (A5836) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.