PHC1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PHC1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5843
• Hersteller Artikelnummer: A5843
• Alternativnummer: ABB-A5843-100UL,ABB-A5843-20UL,ABB-A5843-500UL,ABB-A5843-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EDR1, HPH1, RAE28, MCPH11, PHC1

Produktbeschreibung

This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 106kDa
• NCBI: 1911
• UniProt: P78364
• Reinheit: Affinity purification
• Sequenz: FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRW
• Target-Kategorie: PHC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PHC1 Rabbit pAb (A5843) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.