PHC1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PHC1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5843
• Supplier Catalog Number: A5843
• Alternative Catalog Number: ABB-A5843-100UL,ABB-A5843-20UL,ABB-A5843-500UL,ABB-A5843-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EDR1, HPH1, RAE28, MCPH11, PHC1

Product Description

This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 106kDa
• NCBI: 1911
• UniProt: P78364
• Purity: Affinity purification
• Sequence: FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRW
• Target: PHC1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PHC1 Rabbit pAb (A5843) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.