SKIL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5844
Artikelname: SKIL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5844
Hersteller Artikelnummer: A5844
Alternativnummer: ABB-A5844-100UL,ABB-A5844-20UL,ABB-A5844-1000UL,ABB-A5844-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SNO, SnoA, SnoI, SnoN, SKIL
The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-responsive genes and recruits a nuclear repressor complex. TGFB signaling causes SMAD3 to enter the nucleus and degrade this protein, allowing these genes to be activated. Four transcript variants encoding three different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 6498
UniProt: P12757
Reinheit: Affinity purification
Sequenz: EMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKT
Target-Kategorie: SKIL
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors. Shipping: Ice Bag
Western blot analysis of various lysates using SKIL Rabbit pAb (A5844) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.