SKIL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5844
Article Name: SKIL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5844
Supplier Catalog Number: A5844
Alternative Catalog Number: ABB-A5844-100UL,ABB-A5844-20UL,ABB-A5844-1000UL,ABB-A5844-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SNO, SnoA, SnoI, SnoN, SKIL
The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-responsive genes and recruits a nuclear repressor complex. TGFB signaling causes SMAD3 to enter the nucleus and degrade this protein, allowing these genes to be activated. Four transcript variants encoding three different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 6498
UniProt: P12757
Purity: Affinity purification
Sequence: EMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKT
Target: SKIL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors. Shipping: Ice Bag
Western blot analysis of various lysates using SKIL Rabbit pAb (A5844) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.