Parathyroid Hormone (PTH) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5846
Artikelname: Parathyroid Hormone (PTH) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5846
Hersteller Artikelnummer: A5846
Alternativnummer: ABB-A5846-100UL,ABB-A5846-20UL,ABB-A5846-500UL,ABB-A5846-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FIH1, PTH1, Parathyroid Hormone (PTH)
This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 5741
UniProt: P01270
Reinheit: Affinity purification
Sequenz: LTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Target-Kategorie: PTH
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using Parathyroid Hormone (PTH) Rabbit pAb (A5846) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.