Parathyroid Hormone (PTH) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5846
Article Name: Parathyroid Hormone (PTH) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5846
Supplier Catalog Number: A5846
Alternative Catalog Number: ABB-A5846-100UL,ABB-A5846-20UL,ABB-A5846-500UL,ABB-A5846-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FIH1, PTH1, Parathyroid Hormone (PTH)
This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 5741
UniProt: P01270
Purity: Affinity purification
Sequence: LTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Target: PTH
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using Parathyroid Hormone (PTH) Rabbit pAb (A5846) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.