HNRNPR Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HNRNPR Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5883
• Hersteller Artikelnummer: A5883
• Alternativnummer: ABB-A5883-20UL,ABB-A5883-100UL,ABB-A5883-500UL,ABB-A5883-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HNRPR, NEDDFSB, hnRNP-R, HNRNPR

Produktbeschreibung

This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 71kDa
• NCBI: 10236
• UniProt: O43390
• Reinheit: Affinity purification
• Sequenz: RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
• Target-Kategorie: HNRNPR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using HNRNPR Rabbit pAb (A5883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.