HNRNPR Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HNRNPR Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5883
• Supplier Catalog Number: A5883
• Alternative Catalog Number: ABB-A5883-20UL,ABB-A5883-100UL,ABB-A5883-500UL,ABB-A5883-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HNRPR, NEDDFSB, hnRNP-R, HNRNPR

Product Description

This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 71kDa
• NCBI: 10236
• UniProt: O43390
• Purity: Affinity purification
• Sequence: RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
• Target: HNRNPR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of various lysates using HNRNPR Rabbit pAb (A5883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.