AATF Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: AATF Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5896
• Hersteller Artikelnummer: A5896
• Alternativnummer: ABB-A5896-100UL,ABB-A5896-20UL,ABB-A5896-500UL,ABB-A5896-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DED, BFR2, CHE1, CHE-1, AATF

Produktbeschreibung

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 63kDa
• NCBI: 26574
• UniProt: Q9NY61
• Reinheit: Affinity purification
• Sequenz: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD
• Target-Kategorie: AATF
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using AATF Rabbit pAb (A5896) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.