AATF Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: AATF Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5896
• Supplier Catalog Number: A5896
• Alternative Catalog Number: ABB-A5896-100UL,ABB-A5896-20UL,ABB-A5896-500UL,ABB-A5896-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DED, BFR2, CHE1, CHE-1, AATF

Product Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 63kDa
• NCBI: 26574
• UniProt: Q9NY61
• Purity: Affinity purification
• Sequence: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD
• Target: AATF
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using AATF Rabbit pAb (A5896) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.