STRAP Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: STRAP Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5964
• Hersteller Artikelnummer: A5964
• Alternativnummer: ABB-A5964-100UL,ABB-A5964-20UL,ABB-A5964-1000UL,ABB-A5964-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAWD, PT-WD, UNRIP, STRAP

Produktbeschreibung

Enables RNA binding activity. Involved in maintenance of gastrointestinal epithelium, negative regulation of transforming growth factor beta receptor signaling pathway, and spliceosomal snRNP assembly. Located in cytosol. Part of SMN complex. Implicated in adenocarcinoma, colorectal carcinoma, large cell carcinoma, lung carcinoma, and squamous cell neoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 11171
• UniProt: Q9Y3F4
• Reinheit: Affinity purification
• Sequenz: MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSG
• Target-Kategorie: STRAP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using STRAP Rabbit pAb (A5964) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.