STRAP Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: STRAP Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5964
• Supplier Catalog Number: A5964
• Alternative Catalog Number: ABB-A5964-100UL,ABB-A5964-20UL,ABB-A5964-1000UL,ABB-A5964-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MAWD, PT-WD, UNRIP, STRAP

Product Description

Enables RNA binding activity. Involved in maintenance of gastrointestinal epithelium, negative regulation of transforming growth factor beta receptor signaling pathway, and spliceosomal snRNP assembly. Located in cytosol. Part of SMN complex. Implicated in adenocarcinoma, colorectal carcinoma, large cell carcinoma, lung carcinoma, and squamous cell neoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 11171
• UniProt: Q9Y3F4
• Purity: Affinity purification
• Sequence: MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSG
• Target: STRAP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase. Shipping: Ice Bag

Images

Western blot analysis of various lysates using STRAP Rabbit pAb (A5964) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.