Musashi-2 (MSI2) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Musashi-2 (MSI2) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6004
• Hersteller Artikelnummer: A6004
• Alternativnummer: ABB-A6004-100UL,ABB-A6004-20UL,ABB-A6004-500UL,ABB-A6004-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MSI2H, Musashi-2 (MSI2)

Produktbeschreibung

This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 35kDa
• NCBI: 124540
• UniProt: Q96DH6
• Reinheit: Affinity purification
• Sequenz: MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLG
• Target-Kategorie: MSI2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from mouse brain, using Musashi-2 (MSI2) Rabbit pAb (A6004).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.