Musashi-2 (MSI2) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Musashi-2 (MSI2) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6004
• Supplier Catalog Number: A6004
• Alternative Catalog Number: ABB-A6004-100UL,ABB-A6004-20UL,ABB-A6004-500UL,ABB-A6004-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MSI2H, Musashi-2 (MSI2)

Product Description

This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 35kDa
• NCBI: 124540
• UniProt: Q96DH6
• Purity: Affinity purification
• Sequence: MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLG
• Target: MSI2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of lysates from mouse brain, using Musashi-2 (MSI2) Rabbit pAb (A6004).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.