ANKRD1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ANKRD1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6192
• Hersteller Artikelnummer: A6192
• Alternativnummer: ABB-A6192-100UL,ABB-A6192-20UL,ABB-A6192-500UL,ABB-A6192-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ALRP, CARP, C-193, CVARP, MCARP, bA320F15.2, ANKRD1

Produktbeschreibung

The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36 kDa
• NCBI: 27063
• UniProt: Q15327
• Reinheit: Affinity purification
• Sequenz: MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
• Target-Kategorie: ANKRD1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Jurkat cells, using ANKRD1 Rabbit pAb (A6192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.