ANKRD1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ANKRD1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6192
• Supplier Catalog Number: A6192
• Alternative Catalog Number: ABB-A6192-100UL,ABB-A6192-20UL,ABB-A6192-500UL,ABB-A6192-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ALRP, CARP, C-193, CVARP, MCARP, bA320F15.2, ANKRD1

Product Description

The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36 kDa
• NCBI: 27063
• UniProt: Q15327
• Purity: Affinity purification
• Sequence: MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
• Target: ANKRD1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag

Images

Western blot analysis of lysates from Jurkat cells, using ANKRD1 Rabbit pAb (A6192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.