ADAM5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ADAM5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6196
• Hersteller Artikelnummer: A6196
• Alternativnummer: ABB-A6196-20UL,ABB-A6196-100UL,ABB-A6196-500UL,ABB-A6196-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ADAM5P, TMDCII, ADAM5

Produktbeschreibung

Predicted to be involved in binding activity of sperm to zona pellucida and cell adhesion.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 255926
• UniProt: Q6NVV9
• Reinheit: Affinity purification
• Sequenz: NCGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM
• Target-Kategorie: ADAM5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cytoskeleton,Extracellular Matrix,Ubiquitin. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using ADAM5 Rabbit pAb (A6196) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.