ADAM5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ADAM5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6196
• Supplier Catalog Number: A6196
• Alternative Catalog Number: ABB-A6196-20UL,ABB-A6196-100UL,ABB-A6196-500UL,ABB-A6196-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ADAM5P, TMDCII, ADAM5

Product Description

Predicted to be involved in binding activity of sperm to zona pellucida and cell adhesion.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 255926
• UniProt: Q6NVV9
• Purity: Affinity purification
• Sequence: NCGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM
• Target: ADAM5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cytoskeleton,Extracellular Matrix,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using ADAM5 Rabbit pAb (A6196) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.